Important information

Name

Recombinant Human RANK/TNFRSF11A/CD265 (C-6His)

Size

500 ug

Catalog number

CK64-500

Price

659 €

Extended information

Species reactivity

Human

UniProt number

Q9Y6Q6

Estimated molecular weight

21,1 kDa

Origin

Human cells

Group

recombinants

Shipping condition

Ambient/Room Temperature

Source

Recombinants or rec. proteins

Protein purity

Greater than 95% as determined by reducing SDS-PAGE.

Reconstitution conditions

See included datasheet or contact us for more information.

Endotoxin level

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

Package form

Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.

Description

Recombinant Human Receptor Activator of NF-kappa-B is produced by our Mammalian expression system and the target gene encoding Ile30-Pro212 is expressed with a 6His tag at the C-terminus.

Peptide sequence

IAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLPVDHHHHHH

Storage conditions

Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.

Properties

Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.