Important information
Name
Recombinant Human RANK L/TRANCE/TNFSF11 (N-6His)
Size
50 ug
Catalog number
CK63-50
Price
497 €
Recombinant Human RANK L/TRANCE/TNFSF11 (N-6His)
50 ug
CK63-50
497 €
Human
O14788
22,4 kDa
recombinants
Escherichia coli
Ambient/Room Temperature
Recombinants or rec. proteins
Greater than 95% as determined by reducing SDS-PAGE.
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Lyophilized from a 0.2 µm filtered solution of 20mM Tris,150mM NaCl,pH8.0.
Recombinant Human Receptor Activator of NF-kappa-B ligand is produced by our E.coli expression system and the target gene encoding Ile140-Asp317 is expressed with a 6His tag at the N-terminus.
MGSSHHHHHHSSGLVPRGSHMIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.