Important information

Name

Recombinant Mouse TRANCE/RANK L/TNFSF11 (C-6His)

Size

1 mg

Catalog number

CJ94-1000

Price

2486 €

Extended information

Species reactivity

Mouse

UniProt number

O35235

Estimated molecular weight

28,5 kDa

Origin

Human Cells

Group

recombinants

Latin name

Mus musculus

Shipping condition

Ambient/Room Temperature

Source

Recombinants or rec. proteins

Protein purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin level

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

Package form

Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Description

Recombinant Mouse TNF-related Activation-induced Cytokine is produced by our Mammalian expression system and the target gene encoding Ala73-Asp316 is expressed with a 6His tag at the C-terminus.

Storage conditions

Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.

Peptide sequence

AQMDPNRISEDSTHCFYRILRLHENAGLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDIDVDHHHHHH

Reconstitution conditions

Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Test

Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.